No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010434-M05 |
Product name: | LYPLA1 monoclonal antibody (M05), clone 3D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LYPLA1. |
Clone: | 3D5 |
Isotype: | IgG2a Kappa |
Gene id: | 10434 |
Gene name: | LYPLA1 |
Gene alias: | APT-1|LPL1|LYSOPLA |
Gene description: | lysophospholipase I |
Genbank accession: | BC008652 |
Immunogen: | LYPLA1 (AAH08652.1, 66 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS |
Protein accession: | AAH08652.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged LYPLA1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Thioesterase activity and subcellular localization of acylprotein thioesterase 1/lysophospholipase 1.Hirano T, Kishi M, Sugimoto H, Taguchi R, Obinata H, Ohshima N, Tatei K, Izumi T. Biochim Biophys Acta. 2009 Aug;1791(8):797-805. Epub 2009 May 9. |