No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010432-M01A |
Product name: | RBM14 monoclonal antibody (M01A), clone 4E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM14. |
Clone: | 4E1 |
Isotype: | IgG2a Kappa |
Gene id: | 10432 |
Gene name: | RBM14 |
Gene alias: | COAA|DKFZp779J0927|MGC15912|MGC31756|PSP2|SIP|SYTIP1|TMEM137 |
Gene description: | RNA binding motif protein 14 |
Genbank accession: | BC000488 |
Immunogen: | RBM14 (AAH00488, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQ |
Protein accession: | AAH00488 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |