No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010428-M04 |
| Product name: | CFDP1 monoclonal antibody (M04), clone 5B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CFDP1. |
| Clone: | 5B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10428 |
| Gene name: | CFDP1 |
| Gene alias: | BCNT|BUCENTAUR|CP27|SWC5|Yeti|p97 |
| Gene description: | craniofacial development protein 1 |
| Genbank accession: | NM_006324 |
| Immunogen: | CFDP1 (NP_006315, 168 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESF |
| Protein accession: | NP_006315 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |