| Brand: | Abnova |
| Reference: | H00010423-M02A |
| Product name: | CDIPT monoclonal antibody (M02A), clone 1F8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CDIPT. |
| Clone: | 1F8 |
| Isotype: | IgM Kappa |
| Gene id: | 10423 |
| Gene name: | CDIPT |
| Gene alias: | MGC1328|PIS|PIS1 |
| Gene description: | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) |
| Genbank accession: | BC001444 |
| Immunogen: | CDIPT (AAH01444, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK |
| Protein accession: | AAH01444 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |