Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of YAP1 monoclonal antibody (M01), clone 2F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
More info about YAP1 monoclonal antibody (M01), clone 2F12
| Brand: | Abnova |
| Reference: | H00010413-M01 |
| Product name: | YAP1 monoclonal antibody (M01), clone 2F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant YAP1. |
| Clone: | 2F12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10413 |
| Gene name: | YAP1 |
| Gene alias: | YAP|YAP2|YAP65|YKI |
| Gene description: | Yes-associated protein 1, 65kDa |
| Genbank accession: | NM_006106 |
| Immunogen: | YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR |
| Protein accession: | NP_006097 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to YAP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Asymmetric division of contractile domains couples cell positioning and fate specification.Maitre JL, Turlier H, Illukkumbura R, Eismann B, Niwayama R, Nedelec F, Hiiragi T. Nature. 2016 Aug 18;536(7616):344-8. |