YAP1 monoclonal antibody (M01), clone 2F12 View larger

YAP1 monoclonal antibody (M01), clone 2F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YAP1 monoclonal antibody (M01), clone 2F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr

More info about YAP1 monoclonal antibody (M01), clone 2F12

Brand: Abnova
Reference: H00010413-M01
Product name: YAP1 monoclonal antibody (M01), clone 2F12
Product description: Mouse monoclonal antibody raised against a partial recombinant YAP1.
Clone: 2F12
Isotype: IgG2a Kappa
Gene id: 10413
Gene name: YAP1
Gene alias: YAP|YAP2|YAP65|YKI
Gene description: Yes-associated protein 1, 65kDa
Genbank accession: NM_006106
Immunogen: YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Protein accession: NP_006097
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010413-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010413-M01-3-46-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to YAP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Asymmetric division of contractile domains couples cell positioning and fate specification.Maitre JL, Turlier H, Illukkumbura R, Eismann B, Niwayama R, Nedelec F, Hiiragi T.
Nature. 2016 Aug 18;536(7616):344-8.

Reviews

Buy YAP1 monoclonal antibody (M01), clone 2F12 now

Add to cart