| Brand: | Abnova |
| Reference: | H00010410-D03 |
| Product name: | IFITM3 MaxPab rabbit polyclonal antibody (D03) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human IFITM3 protein. |
| Gene id: | 10410 |
| Gene name: | IFITM3 |
| Gene alias: | 1-8U|IP15 |
| Gene description: | interferon induced transmembrane protein 3 (1-8U) |
| Genbank accession: | BC006794 |
| Immunogen: | IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
| Protein accession: | AAH06794 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | IFITM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in human liver. |
| Applications: | WB-Ce,WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |