ANAPC10 MaxPab mouse polyclonal antibody (B02) View larger

ANAPC10 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANAPC10 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about ANAPC10 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00010393-B02
Product name: ANAPC10 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human ANAPC10 protein.
Gene id: 10393
Gene name: ANAPC10
Gene alias: APC10|DKFZp564L0562|DOC1
Gene description: anaphase promoting complex subunit 10
Genbank accession: BC005217
Immunogen: ANAPC10 (AAH05217, 1 a.a. ~ 185 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Protein accession: AAH05217
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010393-B02-13-15-1.jpg
Application image note: Western Blot analysis of ANAPC10 expression in transfected 293T cell line (H00010393-T02) by ANAPC10 MaxPab polyclonal antibody.

Lane 1: ANAPC10 transfected lysate(20.35 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANAPC10 MaxPab mouse polyclonal antibody (B02) now

Add to cart