CORO2B MaxPab mouse polyclonal antibody (B01) View larger

CORO2B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CORO2B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about CORO2B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00010391-B01
Product name: CORO2B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CORO2B protein.
Gene id: 10391
Gene name: CORO2B
Gene alias: CLIPINC|KIAA0925
Gene description: coronin, actin binding protein, 2B
Genbank accession: BC026335.1
Immunogen: CORO2B (AAH26335.1, 1 a.a. ~ 475 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLVTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRRSDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC
Protein accession: AAH26335.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010391-B01-13-15-1.jpg
Application image note: Western Blot analysis of CORO2B expression in transfected 293T cell line (H00010391-T01) by CORO2B MaxPab polyclonal antibody.

Lane 1: CORO2B transfected lysate(52.25 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CORO2B MaxPab mouse polyclonal antibody (B01) now

Add to cart