Brand: | Abnova |
Reference: | H00010383-A01 |
Product name: | TUBB4B polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant TUBB4B. |
Gene id: | 10383 |
Gene name: | TUBB4B |
Gene alias: | RP13-122B23.2|Beta2|TUBB2|TUBB2C |
Gene description: | tubulin, beta 4B class IVb |
Genbank accession: | BC001911 |
Immunogen: | TUBB4B (AAH01911, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA |
Protein accession: | AAH01911 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |