BPNT1 MaxPab mouse polyclonal antibody (B01) View larger

BPNT1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BPNT1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about BPNT1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00010380-B01
Product name: BPNT1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human BPNT1 protein.
Gene id: 10380
Gene name: BPNT1
Gene alias: PIP
Gene description: 3'(2'), 5'-bisphosphate nucleotidase 1
Genbank accession: NM_006085
Immunogen: BPNT1 (NP_006076, 1 a.a. ~ 261 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGAS
Protein accession: NP_006076
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010380-B01-13-15-1.jpg
Application image note: Western Blot analysis of BPNT1 expression in transfected 293T cell line (H00010380-T01) by BPNT1 MaxPab polyclonal antibody.

Lane 1: BPNT1 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BPNT1 MaxPab mouse polyclonal antibody (B01) now

Add to cart