IRF9 purified MaxPab mouse polyclonal antibody (B01P) View larger

IRF9 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRF9 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about IRF9 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010379-B01P
Product name: IRF9 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human IRF9 protein.
Gene id: 10379
Gene name: IRF9
Gene alias: IRF-9|ISGF3|ISGF3G|p48
Gene description: interferon regulatory factor 9
Genbank accession: NM_006084.4
Immunogen: IRF9 (NP_006075.3, 1 a.a. ~ 393 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
Protein accession: NP_006075.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010379-B01P-13-15-1.jpg
Application image note: Western Blot analysis of IRF9 expression in transfected 293T cell line (H00010379-T01) by IRF9 MaxPab polyclonal antibody.

Lane 1: ISGF3G transfected lysate(43.23 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IRF9 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart