SEMA3A monoclonal antibody (M01A), clone 5G9 View larger

SEMA3A monoclonal antibody (M01A), clone 5G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEMA3A monoclonal antibody (M01A), clone 5G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SEMA3A monoclonal antibody (M01A), clone 5G9

Brand: Abnova
Reference: H00010371-M01A
Product name: SEMA3A monoclonal antibody (M01A), clone 5G9
Product description: Mouse monoclonal antibody raised against a partial recombinant SEMA3A.
Clone: 5G9
Isotype: IgG2a Kappa
Gene id: 10371
Gene name: SEMA3A
Gene alias: Hsema-I|Hsema-III|MGC133243|SEMA1|SEMAD|SEMAIII|SEMAL|SemD|coll-1
Gene description: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
Genbank accession: NM_006080
Immunogen: SEMA3A (NP_006071, 672 a.a. ~ 770 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS
Protein accession: NP_006071
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010371-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SEMA3A monoclonal antibody (M01A), clone 5G9 now

Add to cart