Brand: | Abnova |
Reference: | H00010371-M01A |
Product name: | SEMA3A monoclonal antibody (M01A), clone 5G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SEMA3A. |
Clone: | 5G9 |
Isotype: | IgG2a Kappa |
Gene id: | 10371 |
Gene name: | SEMA3A |
Gene alias: | Hsema-I|Hsema-III|MGC133243|SEMA1|SEMAD|SEMAIII|SEMAL|SemD|coll-1 |
Gene description: | sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A |
Genbank accession: | NM_006080 |
Immunogen: | SEMA3A (NP_006071, 672 a.a. ~ 770 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS |
Protein accession: | NP_006071 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |