View larger

CITED2 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of CITED2 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00010370-B01P
Product name:	CITED2 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human CITED2 protein.
Gene id:	10370
Gene name:	CITED2
Gene alias:	MRG1\|P35SRJ
Gene description:	Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2
Genbank accession:	NM_006079.3
Immunogen:	CITED2 (NP_006070.2, 1 a.a. ~ 270 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
Protein accession:	NP_006070.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of CITED2 expression in transfected 293T cell line (H00010370-T01) by CITED2 MaxPab polyclonal antibody. Lane 1: CITED2 transfected lysate(29.7 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice