| Brand: | Abnova |
| Reference: | H00010368-B01P |
| Product name: | CACNG3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CACNG3 protein. |
| Gene id: | 10368 |
| Gene name: | CACNG3 |
| Gene alias: | Cacng2 |
| Gene description: | calcium channel, voltage-dependent, gamma subunit 3 |
| Genbank accession: | NM_006539 |
| Immunogen: | CACNG3 (NP_006530.1, 1 a.a. ~ 315 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV |
| Protein accession: | NP_006530.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of purified MaxPab antibody to CACNG3 on 293T cell. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |