CACNG3 purified MaxPab mouse polyclonal antibody (B01P) View larger

CACNG3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CACNG3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about CACNG3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010368-B01P
Product name: CACNG3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CACNG3 protein.
Gene id: 10368
Gene name: CACNG3
Gene alias: Cacng2
Gene description: calcium channel, voltage-dependent, gamma subunit 3
Genbank accession: NM_006539
Immunogen: CACNG3 (NP_006530.1, 1 a.a. ~ 315 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV
Protein accession: NP_006530.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010368-B01P-4-15-1-L.jpg
Application image note: Immunofluorescence of purified MaxPab antibody to CACNG3 on 293T cell. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CACNG3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart