Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KLF2 monoclonal antibody (M09), clone 1D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about KLF2 monoclonal antibody (M09), clone 1D12
| Brand: | Abnova |
| Reference: | H00010365-M09 |
| Product name: | KLF2 monoclonal antibody (M09), clone 1D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF2. |
| Clone: | 1D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10365 |
| Gene name: | KLF2 |
| Gene alias: | LKLF |
| Gene description: | Kruppel-like factor 2 (lung) |
| Genbank accession: | NM_016270 |
| Immunogen: | KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH |
| Protein accession: | NP_057354 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | KLF2 monoclonal antibody (M09), clone 1D12. Western Blot analysis of KLF2 expression in IMR-32. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Kruppel-like Factor 2 Modulates CCR5 Expression and Susceptibility to HIV-1 Infection.Richardson MW, Jadlowsky J, Didigu CA, Doms RW, Riley JL. J Immunol. 2012 Oct 15;189(8):3815-21. doi: 10.4049/jimmunol.1201431. Epub 2012 Sep 17. |