Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KLF2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about KLF2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010365-A01 |
| Product name: | KLF2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KLF2. |
| Gene id: | 10365 |
| Gene name: | KLF2 |
| Gene alias: | LKLF |
| Gene description: | Kruppel-like factor 2 (lung) |
| Genbank accession: | NM_016270 |
| Immunogen: | KLF2 (NP_057354, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL |
| Protein accession: | NP_057354 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.27 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | KLF2 polyclonal antibody (A01), Lot # HMS31060314QCS1. Western Blot analysis of KLF2 expression in Raw 264.7. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |