Brand: | Abnova |
Reference: | H00010365-A01 |
Product name: | KLF2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KLF2. |
Gene id: | 10365 |
Gene name: | KLF2 |
Gene alias: | LKLF |
Gene description: | Kruppel-like factor 2 (lung) |
Genbank accession: | NM_016270 |
Immunogen: | KLF2 (NP_057354, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL |
Protein accession: | NP_057354 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.27 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | KLF2 polyclonal antibody (A01), Lot # HMS31060314QCS1. Western Blot analysis of KLF2 expression in Raw 264.7. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |