WARS2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

WARS2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WARS2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about WARS2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00010352-D01P
Product name: WARS2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human WARS2 protein.
Gene id: 10352
Gene name: WARS2
Gene alias: TrpRS
Gene description: tryptophanyl tRNA synthetase 2, mitochondrial
Genbank accession: NM_201263.1
Immunogen: WARS2 (NP_957715.1, 1 a.a. ~ 220 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILSMCVLVFLT
Protein accession: NP_957715.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00010352-D01P-13-15-1.jpg
Application image note: Western Blot analysis of WARS2 expression in transfected 293T cell line (H00010352-T02) by WARS2 MaxPab polyclonal antibody.

Lane 1: WARS2 transfected lysate(24.80 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WARS2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart