Brand: | Abnova |
Reference: | H00010349-A01 |
Product name: | ABCA10 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ABCA10. |
Gene id: | 10349 |
Gene name: | ABCA10 |
Gene alias: | EST698739 |
Gene description: | ATP-binding cassette, sub-family A (ABC1), member 10 |
Genbank accession: | NM_080282 |
Immunogen: | ABCA10 (NP_525021, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL |
Protein accession: | NP_525021 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.91 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ABCA10 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of ABCA10 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |