| Brand: | Abnova |
| Reference: | H00010349-A01 |
| Product name: | ABCA10 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ABCA10. |
| Gene id: | 10349 |
| Gene name: | ABCA10 |
| Gene alias: | EST698739 |
| Gene description: | ATP-binding cassette, sub-family A (ABC1), member 10 |
| Genbank accession: | NM_080282 |
| Immunogen: | ABCA10 (NP_525021, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL |
| Protein accession: | NP_525021 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.91 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ABCA10 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of ABCA10 expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |