Cart 64 Product Products 22 880,14 € (empty)
No products
To be determined Shipping
22 880,14 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 64 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 22 880,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 22 880,14 €
Data sheet of TFG purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about TFG purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010342-B01P |
| Product name: | TFG purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TFG protein. |
| Gene id: | 10342 |
| Gene name: | TFG |
| Gene alias: | FLJ36137|TF6|TRKT3 |
| Gene description: | TRK-fused gene |
| Genbank accession: | BC009241 |
| Immunogen: | TFG (AAH09241, 1 a.a. ~ 400 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR |
| Protein accession: | AAH09241 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TFG expression in transfected 293T cell line (H00010342-T01) by TFG MaxPab polyclonal antibody. Lane 1: TFG transfected lysate(44 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |