PCGF3 purified MaxPab mouse polyclonal antibody (B01P) View larger

PCGF3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCGF3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about PCGF3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010336-B01P
Product name: PCGF3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PCGF3 protein.
Gene id: 10336
Gene name: PCGF3
Gene alias: DKFZp686D20235|DONG1|FLJ36550|FLJ43813|MGC129615|MGC40413|RNF3|RNF3A
Gene description: polycomb group ring finger 3
Genbank accession: NM_006315.4
Immunogen: PCGF3 (NP_006306.2, 1 a.a. ~ 242 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
Protein accession: NP_006306.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010336-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PCGF3 expression in transfected 293T cell line (H00010336-T01) by PCGF3 MaxPab polyclonal antibody.

Lane 1: PCGF3 transfected lysate(26.62 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCGF3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart