No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00010333-M07 |
Product name: | TLR6 monoclonal antibody (M07), clone 4H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR6. |
Clone: | 4H3 |
Isotype: | IgG2a Kappa |
Gene id: | 10333 |
Gene name: | TLR6 |
Gene alias: | CD286 |
Gene description: | toll-like receptor 6 |
Genbank accession: | NM_006068 |
Immunogen: | TLR6 (NP_006059, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS |
Protein accession: | NP_006059 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged TLR6 is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |