| Brand: | Abnova |
| Reference: | H00010331-A01 |
| Product name: | B3GNT3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant B3GNT3. |
| Gene id: | 10331 |
| Gene name: | B3GNT3 |
| Gene alias: | B3GAL-T8|B3GN-T3|B3GNT-3|HP10328|TMEM3|beta3Gn-T3 |
| Gene description: | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 |
| Genbank accession: | NM_014256 |
| Immunogen: | B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN |
| Protein accession: | NP_055071 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.25 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | B3GNT3 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of B3GNT3 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |