Cart 1 Product Products 102,78 € (empty)
No products
To be determined Shipping
102,78 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 102,78 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 102,78 €
Data sheet of B3GALT5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about B3GALT5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010317-A01 |
| Product name: | B3GALT5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant B3GALT5. |
| Gene id: | 10317 |
| Gene name: | B3GALT5 |
| Gene alias: | B3GalT-V|B3GalTx|B3T5|GLCT5|beta3Gal-T5 |
| Gene description: | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 |
| Genbank accession: | NM_006057 |
| Immunogen: | B3GALT5 (NP_006048, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVY |
| Protein accession: | NP_006048 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |