Brand: | Abnova |
Reference: | H00010317-A01 |
Product name: | B3GALT5 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant B3GALT5. |
Gene id: | 10317 |
Gene name: | B3GALT5 |
Gene alias: | B3GalT-V|B3GalTx|B3T5|GLCT5|beta3Gal-T5 |
Gene description: | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 |
Genbank accession: | NM_006057 |
Immunogen: | B3GALT5 (NP_006048, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVY |
Protein accession: | NP_006048 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |