B3GALT5 polyclonal antibody (A01) View larger

B3GALT5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of B3GALT5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about B3GALT5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010317-A01
Product name: B3GALT5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant B3GALT5.
Gene id: 10317
Gene name: B3GALT5
Gene alias: B3GalT-V|B3GalTx|B3T5|GLCT5|beta3Gal-T5
Gene description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Genbank accession: NM_006057
Immunogen: B3GALT5 (NP_006048, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVY
Protein accession: NP_006048
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010317-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy B3GALT5 polyclonal antibody (A01) now

Add to cart