Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LANCL1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
More info about LANCL1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010314-A01 |
| Product name: | LANCL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LANCL1. |
| Gene id: | 10314 |
| Gene name: | LANCL1 |
| Gene alias: | GPR69A|p40 |
| Gene description: | LanC lantibiotic synthetase component C-like 1 (bacterial) |
| Genbank accession: | NM_006055 |
| Immunogen: | LANCL1 (NP_006046, 1 a.a. ~ 58 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRD |
| Protein accession: | NP_006046 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LANCL1 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of LANCL1 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Lantibiotic Cyclase-like protein 2 (LanCL2) is a novel regulator of Akt.Zeng M, van der Donk WA, Chen J. Mol Biol Cell. 2014 Oct 1. pii: mbc.E14-01-0004. |