| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00010313-D01P |
| Product name: | RTN3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human RTN3 protein. |
| Gene id: | 10313 |
| Gene name: | RTN3 |
| Gene alias: | ASYIP|HAP|NSPL2|NSPLII|RTN3-A1 |
| Gene description: | reticulon 3 |
| Genbank accession: | NM_006054.2 |
| Immunogen: | RTN3 (NP_006045.1, 1 a.a. ~ 236 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE |
| Protein accession: | NP_006045.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of RTN3 expression in transfected 293T cell line (H00010313-T02) by RTN3 MaxPab polyclonal antibody. Lane 1: RTN3 transfected lysate(25.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |