Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TCIRG1 monoclonal antibody (M01), clone 6H3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TCIRG1 monoclonal antibody (M01), clone 6H3
| Brand: | Abnova |
| Reference: | H00010312-M01 |
| Product name: | TCIRG1 monoclonal antibody (M01), clone 6H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TCIRG1. |
| Clone: | 6H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10312 |
| Gene name: | TCIRG1 |
| Gene alias: | ATP6N1C|ATP6V0A3|Atp6i|OC-116kDa|OC116|OPTB1|Stv1|TIRC7|Vph1|a3 |
| Gene description: | T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 |
| Genbank accession: | BC018133 |
| Immunogen: | TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL |
| Protein accession: | AAH18133 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A specific subtype of osteoclasts secretes factors inducing nodule formation by osteoblasts.Henriksen K, Andreassen KV, Thudium CS, Gudmann KN, Moscatelli I, Cruger-Hansen CE, Schulz AS, Dziegiel MH, Richter J, Karsdal MA, Neutzsky-Wulff AV. Bone. 2012 Jun 19;51(3):353-361. |