| Brand: | Abnova |
| Reference: | H00010312-A01 |
| Product name: | TCIRG1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TCIRG1. |
| Gene id: | 10312 |
| Gene name: | TCIRG1 |
| Gene alias: | ATP6N1C|ATP6V0A3|Atp6i|OC-116kDa|OC116|OPTB1|Stv1|TIRC7|Vph1|a3 |
| Gene description: | T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 |
| Genbank accession: | BC018133 |
| Immunogen: | TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL |
| Protein accession: | AAH18133 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |