MARCH6 polyclonal antibody (A01) View larger

MARCH6 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MARCH6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MARCH6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010299-A01
Product name: MARCH6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MARCH6.
Gene id: 10299
Gene name: MARCH6
Gene alias: KIAA0597|MARCH-VI|RNF176|TEB4
Gene description: membrane-associated ring finger (C3HC4) 6
Genbank accession: NM_005885
Immunogen: 40974 (NP_005876, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR
Protein accession: NP_005876
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010299-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010299-A01-1-22-1.jpg
Application image note: MARCH6 polyclonal antibody (A01), Lot # 051107JC01 Western Blot analysis of MARCH6 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MARCH6 polyclonal antibody (A01) now

Add to cart