Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00010290-D01P |
Product name: | SPEG purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SPEG protein. |
Gene id: | 10290 |
Gene name: | SPEG |
Gene alias: | APEG1|BPEG|KIAA1297|MGC12676|SPEGalpha|SPEGbeta |
Gene description: | SPEG complex locus |
Genbank accession: | BC006346.2 |
Immunogen: | SPEG (AAH06346.1, 1 a.a. ~ 113 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE |
Protein accession: | AAH06346.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SPEG expression in transfected 293T cell line (H00010290-T01) by SPEG MaxPab polyclonal antibody. Lane 1: SPEG transfected lysate(12.70 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |