LILRB2 purified MaxPab mouse polyclonal antibody (B01P) View larger

LILRB2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LILRB2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LILRB2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010288-B01P
Product name: LILRB2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human LILRB2 protein.
Gene id: 10288
Gene name: LILRB2
Gene alias: CD85D|ILT4|LILRA6|LIR-2|LIR2|MIR-10|MIR10
Gene description: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
Genbank accession: BC041708.1
Immunogen: LILRB2 (AAH41708.1, 1 a.a. ~ 193 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
Protein accession: AAH41708.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010288-B01P-13-15-1.jpg
Application image note: Western Blot analysis of LILRB2 expression in transfected 293T cell line (H00010288-T01) by LILRB2 MaxPab polyclonal antibody.

Lane 1: LILRB2 transfected lysate(21.23 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LILRB2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart