Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BCAS2 monoclonal antibody (M01), clone 1D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about BCAS2 monoclonal antibody (M01), clone 1D10
| Brand: | Abnova |
| Reference: | H00010286-M01 |
| Product name: | BCAS2 monoclonal antibody (M01), clone 1D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BCAS2. |
| Clone: | 1D10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10286 |
| Gene name: | BCAS2 |
| Gene alias: | DAM1 |
| Gene description: | breast carcinoma amplified sequence 2 |
| Genbank accession: | NM_005872 |
| Immunogen: | BCAS2 (NP_005863, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
| Protein accession: | NP_005863 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | BCAS2 monoclonal antibody (M01), clone 1D10 Western Blot analysis of BCAS2 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | A Quantitative Proteomic Analysis Uncovers the Relevance of CUL3 in Bladder Cancer Aggressiveness.Grau L, Luque-Garcia JL, Gonzalez-Peramato P, Theodorescu D, Palou J, Fernandez-Gomez JM, Sanchez-Carbayo M. PLoS One. 2013;8(1):e53328. doi: 10.1371/journal.pone.0053328. Epub 2013 Jan 8. |