No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010285-M01 |
Product name: | SMNDC1 monoclonal antibody (M01), clone 2B9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SMNDC1. |
Clone: | 2B9 |
Isotype: | IgG1 kappa |
Gene id: | 10285 |
Gene name: | SMNDC1 |
Gene alias: | SMNR|SPF30 |
Gene description: | survival motor neuron domain containing 1 |
Genbank accession: | BC011234 |
Immunogen: | SMNDC1 (AAH11234, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ |
Protein accession: | AAH11234 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (51.92 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to SMNDC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |