No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IP |
| Brand: | Abnova |
| Reference: | H00010284-D01 |
| Product name: | SAP18 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SAP18 protein. |
| Gene id: | 10284 |
| Gene name: | SAP18 |
| Gene alias: | 2HOR0202|MGC27131|SAP18P |
| Gene description: | Sin3A-associated protein, 18kDa |
| Genbank accession: | NM_005870.3 |
| Immunogen: | SAP18 (NP_005861.1, 1 a.a. ~ 153 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY |
| Protein accession: | NP_005861.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoprecipitation of SAP18 transfected lysate using anti-SAP18 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SAP18 purified MaxPab mouse polyclonal antibody (B01P) (H00010284-B01P). |
| Applications: | IP |
| Shipping condition: | Dry Ice |
| Publications: | Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA Cell Cycle. 2012 Jun 15;11(12):2367-79. doi: 10.4161/cc.20863. Epub 2012 Jun 15. |