Brand: | Abnova |
Reference: | H00010270-A01 |
Product name: | AKAP8 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant AKAP8. |
Gene id: | 10270 |
Gene name: | AKAP8 |
Gene alias: | AKAP95|DKFZp586B1222 |
Gene description: | A kinase (PRKA) anchor protein 8 |
Genbank accession: | NM_005858 |
Immunogen: | AKAP8 (NP_005849, 551 a.a. ~ 662 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAES |
Protein accession: | NP_005849 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |