View larger

GLYAT purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of GLYAT purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00010249-B01P
Product name:	GLYAT purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human GLYAT protein.
Gene id:	10249
Gene name:	GLYAT
Gene alias:	ACGNAT\|CAT\|GAT
Gene description:	glycine-N-acyltransferase
Genbank accession:	BC009785.1
Immunogen:	GLYAT (AAH09785.1, 1 a.a. ~ 163 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MMLPLQGAQMLQMLEKTLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAM
Protein accession:	AAH09785.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of GLYAT expression in transfected 293T cell line (H00010249-T01) by GLYAT MaxPab polyclonal antibody. Lane 1: GLYAT transfected lysate(17.93 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice