GPHN polyclonal antibody (A01) View larger

GPHN polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPHN polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GPHN polyclonal antibody (A01)

Brand: Abnova
Reference: H00010243-A01
Product name: GPHN polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GPHN.
Gene id: 10243
Gene name: GPHN
Gene alias: GEPH|GPH|GPHRYN|KIAA1385
Gene description: gephyrin
Genbank accession: NM_020806
Immunogen: GPHN (NP_065857, 677 a.a. ~ 769 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL
Protein accession: NP_065857
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010243-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010243-A01-1-6-1.jpg
Application image note: GPHN polyclonal antibody (A01), Lot # 060118JC01 Western Blot analysis of GPHN expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GPHN polyclonal antibody (A01) now

Add to cart