AP3S2 MaxPab mouse polyclonal antibody (B01) View larger

AP3S2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP3S2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about AP3S2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00010239-B01
Product name: AP3S2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human AP3S2 protein.
Gene id: 10239
Gene name: AP3S2
Gene alias: AP3S3|FLJ35955|sigma3b
Gene description: adaptor-related protein complex 3, sigma 2 subunit
Genbank accession: NM_005829.3
Immunogen: AP3S2 (NP_005820.1, 1 a.a. ~ 193 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
Protein accession: NP_005820.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010239-B01-13-15-1.jpg
Application image note: Western Blot analysis of AP3S2 expression in transfected 293T cell line (H00010239-T01) by AP3S2 MaxPab polyclonal antibody.

Lane 1: AP3S2 transfected lysate(21.23 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AP3S2 MaxPab mouse polyclonal antibody (B01) now

Add to cart