WDR68 purified MaxPab mouse polyclonal antibody (B01P) View larger

WDR68 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDR68 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about WDR68 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010238-B01P
Product name: WDR68 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human WDR68 protein.
Gene id: 10238
Gene name: WDR68
Gene alias: AN11|HAN11
Gene description: WD repeat domain 68
Genbank accession: NM_005828
Immunogen: WDR68 (NP_005819, 1 a.a. ~ 342 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Protein accession: NP_005819
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010238-B01P-13-15-1.jpg
Application image note: Western Blot analysis of WDR68 expression in transfected 293T cell line by WDR68 MaxPab polyclonal antibody.

Lane 1: WDR68 transfected lysate(37.62 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WDR68 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart