| Brand: | Abnova |
| Reference: | H00010221-M01 |
| Product name: | TRIB1 monoclonal antibody (M01), clone 4A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIB1. |
| Clone: | 4A10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10221 |
| Gene name: | TRIB1 |
| Gene alias: | C8FW|GIG2|SKIP1 |
| Gene description: | tribbles homolog 1 (Drosophila) |
| Genbank accession: | NM_025195 |
| Immunogen: | TRIB1 (NP_079471, 91 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVS |
| Protein accession: | NP_079471 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TRIB1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expulsion of micronuclei containing amplified genes contributes to a decrease in double minute chromosomes from malignant tumor cells.Ji W, Bian Z, Yu Y, Yuan C, Liu Y, Yu L, Li C, Zhu J, Jia X, Guan R, Zhang C, Meng X, Jin Y, Bai J, Yu J, Lee KY, Sun W, Fu S. Int. J. Cancer. doi: 10.1002/ijc.28467 |