No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00010220-M01 |
Product name: | GDF11 monoclonal antibody (M01), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GDF11. |
Clone: | 3G6 |
Isotype: | IgG2b Kappa |
Gene id: | 10220 |
Gene name: | GDF11 |
Gene alias: | BMP-11|BMP11 |
Gene description: | growth differentiation factor 11 |
Genbank accession: | NM_005811 |
Immunogen: | GDF11 (NP_005802, 310 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
Protein accession: | NP_005802 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to GDF11 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |