Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of KLRG1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about KLRG1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010219-A01 |
| Product name: | KLRG1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KLRG1. |
| Gene id: | 10219 |
| Gene name: | KLRG1 |
| Gene alias: | 2F1|CLEC15A|MAFA|MAFA-2F1|MAFA-L|MAFA-LIKE|MGC13600 |
| Gene description: | killer cell lectin-like receptor subfamily G, member 1 |
| Genbank accession: | NM_005810 |
| Immunogen: | KLRG1 (NP_005801, 57 a.a. ~ 119 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEM |
| Protein accession: | NP_005801 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.04 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cell-to-Cell Contact with Hepatitis C Virus-Infected Cells Reduces Functional Capacity of Natural Killer Cells.Yoon JC, Lim JB, Park JH, Lee JM. J Virol. 2011 Sep 21. [Epub ahead of print] |