| Brand: | Abnova |
| Reference: | H00010215-M03 |
| Product name: | OLIG2 monoclonal antibody (M03), clone 3C9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant OLIG2. |
| Clone: | 3C9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10215 |
| Gene name: | OLIG2 |
| Gene alias: | BHLHB1|OLIGO2|PRKCBP2|RACK17|bHLHe19 |
| Gene description: | oligodendrocyte lineage transcription factor 2 |
| Genbank accession: | NM_005806 |
| Immunogen: | OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS |
| Protein accession: | NP_005797 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.47 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to OLIG2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human Cytomegalovirus Tegument Protein pp65 Is Detected in All Intra- and Extra-Axial Brain Tumours Independent of the Tumour Type or Grade.Libard S, Popova SN, Amini RM, Karja V, Pietilainen T, Hamalainen KM, Sundstrom C, Hesselager G, Bergqvist M, Ekman S, Zetterling M, Smits A, Nilsson P, Pfeifer S, de Stahl TD, Enblad G, Ponten F, Alafuzoff I PLoS One. 2014 Sep 30;9(9):e108861. doi: 10.1371/journal.pone.0108861. eCollection 2014. |