Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SSX3 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | WB-Tr |
More info about SSX3 MaxPab mouse polyclonal antibody (B01)
| Product description: | Mouse polyclonal antibody raised against a full-length human SSX3 protein. |
| Gene id: | 10214 |
| Gene name: | SSX3 |
| Gene alias: | MGC119054|MGC14495 |
| Gene description: | synovial sarcoma, X breakpoint 3 |
| Genbank accession: | NM_021014.2 |
| Immunogen: | SSX3 (NP_066294.1, 1 a.a. ~ 188 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE |
| Protein accession: | NP_066294.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Size: | 50 uL |
| Shipping condition: | Dry Ice |