| Brand: | Abnova |
| Reference: | H00010206-A01 |
| Product name: | RFP2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RFP2. |
| Gene id: | 10206 |
| Gene name: | TRIM13 |
| Gene alias: | CAR|DLEU5|LEU5|RFP2|RNF77 |
| Gene description: | tripartite motif-containing 13 |
| Genbank accession: | NM_005798 |
| Immunogen: | RFP2 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ |
| Protein accession: | NP_005789 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RFP2 polyclonal antibody (A01), Lot # UYL6060127QCS1 Western Blot analysis of RFP2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |