| Brand: | Abnova |
| Reference: | H00010205-M06 |
| Product name: | MPZL2 monoclonal antibody (M06), clone 2E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MPZL2. |
| Clone: | 2E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10205 |
| Gene name: | MPZL2 |
| Gene alias: | EVA|EVA1 |
| Gene description: | myelin protein zero-like 2 |
| Genbank accession: | NM_005797 |
| Immunogen: | MPZL2 (NP_005788.1, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIG |
| Protein accession: | NP_005788.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MPZL2 is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |