Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CALCRL polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CALCRL polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010203-A01 |
| Product name: | CALCRL polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CALCRL. |
| Gene id: | 10203 |
| Gene name: | CALCRL |
| Gene alias: | CGRPR|CRLR |
| Gene description: | calcitonin receptor-like |
| Genbank accession: | NM_005795 |
| Immunogen: | CALCRL (NP_005786, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTH |
| Protein accession: | NP_005786 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CALCRL polyclonal antibody (A01), Lot # UHK2060109QCS1 Western Blot analysis of CALCRL expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |