| Brand: | Abnova |
| Reference: | H00010200-M12 |
| Product name: | MPHOSPH6 monoclonal antibody (M12), clone 3G8-2F5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MPHOSPH6. |
| Clone: | 3G8-2F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10200 |
| Gene name: | MPHOSPH6 |
| Gene alias: | MPP|MPP-6|MPP6 |
| Gene description: | M-phase phosphoprotein 6 |
| Genbank accession: | BC005242 |
| Immunogen: | MPHOSPH6 (AAH05242, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD |
| Protein accession: | AAH05242 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MPHOSPH6 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |