| Brand: | Abnova |
| Reference: | H00010190-M02 |
| Product name: | TXNDC9 monoclonal antibody (M02), clone 1E8-7C12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TXNDC9. |
| Clone: | 1E8-7C12 |
| Isotype: | IgG2b kappa |
| Gene id: | 10190 |
| Gene name: | TXNDC9 |
| Gene alias: | APACD |
| Gene description: | thioredoxin domain containing 9 |
| Genbank accession: | BC005968 |
| Immunogen: | TXNDC9 (AAH05968, 1 a.a. ~ 226 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD |
| Protein accession: | AAH05968 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (50.6 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TXNDC9 monoclonal antibody (M02), clone 1E8-7C12 Western Blot analysis of TXNDC9 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |