No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010181-M02 |
Product name: | RBM5 monoclonal antibody (M02), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM5. |
Clone: | 3G6 |
Isotype: | IgG2a Kappa |
Gene id: | 10181 |
Gene name: | RBM5 |
Gene alias: | FLJ39876|G15|H37|LUCA15|RMB5 |
Gene description: | RNA binding motif protein 5 |
Genbank accession: | BC002957 |
Immunogen: | RBM5 (AAH02957, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFED |
Protein accession: | AAH02957 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody (M02), clone 3G6. Lane 1: RBM5 transfected lysate (Predicted MW: 61.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |