No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010180-M16 |
Product name: | RBM6 monoclonal antibody (M16), clone 4B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM6. |
Clone: | 4B3 |
Isotype: | IgG2a Kappa |
Gene id: | 10180 |
Gene name: | RBM6 |
Gene alias: | 3G2|DEF-3|DEF3|DKFZp686B0877|FLJ36517|HLC-11|NY-LU-12|g16 |
Gene description: | RNA binding motif protein 6 |
Genbank accession: | NM_005777 |
Immunogen: | RBM6 (NP_005768.1, 1024 a.a. ~ 1123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD |
Protein accession: | NP_005768.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RBM6 expression in transfected 293T cell line by RBM6 monoclonal antibody (M16), clone 4B3. Lane 1: RBM6 transfected lysate(69.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |